PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04197.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 339aa    MW: 38210.4 Da    PI: 5.073
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04197.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.65e-5361331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv +yLk+k++g ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rdkky++g+r+nratksgyWk
  Sme2.5_04197.1_g00005.1   6 LPPGFRFHPTDEELVGYYLKRKTDGLEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDLEWFFFCPRDKKYPNGSRTNRATKSGYWK 90 
                              79****************************.99**************95334445667**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v + + e vg +ktLvfy+grap g +tdWvmheyrl
  Sme2.5_04197.1_g00005.1  91 ATGKDRKVAC-HPEIVGYRKTLVFYRGRAPLGDRTDWVMHEYRL 133
                              **********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-614156IPR003441NAC domain
PROSITE profilePS5100557.9286156IPR003441NAC domain
PfamPF023651.3E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MAGTSLPPGF RFHPTDEELV GYYLKRKTDG LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DLEWFFFCPR DKKYPNGSRT NRATKSGYWK ATGKDRKVAC HPEIVGYRKT LVFYRGRAPL  120
GDRTDWVMHE YRLCDDVTQG TPSFQGPFAL CRVIKRNDAS LKTKDVQASK QVGCSTSTTS  180
GTFTSVNEPT ALSDETPTQS AYMSNDSNYS TPITSPYQTT QFGDYESAIG ANSSNLWMSS  240
AMILDSSKEC PQGQNASSYC PQYDFPSMTP WQPSDQYDFT SNSTFPTFRG EVELSGDLSS  300
FGCLSPYSIH GSYVGLYGNE DMTYEGFNQN NSNKNPNFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-53116212171NO APICAL MERISTEM PROTEIN
1ut4_B2e-53116212171NO APICAL MERISTEM PROTEIN
1ut7_A2e-53116212171NO APICAL MERISTEM PROTEIN
1ut7_B2e-53116212171NO APICAL MERISTEM PROTEIN
3swm_A2e-53116215174NAC domain-containing protein 19
3swm_B2e-53116215174NAC domain-containing protein 19
3swm_C2e-53116215174NAC domain-containing protein 19
3swm_D2e-53116215174NAC domain-containing protein 19
3swp_A2e-53116215174NAC domain-containing protein 19
3swp_B2e-53116215174NAC domain-containing protein 19
3swp_C2e-53116215174NAC domain-containing protein 19
3swp_D2e-53116215174NAC domain-containing protein 19
4dul_A2e-53116212171NAC domain-containing protein 19
4dul_B2e-53116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083911.10.0PREDICTED: protein ATAF2-like
SwissprotA4VCM03e-73NAC45_ARATH; NAC domain-containing protein 45
TrEMBLK4CN710.0K4CN71_SOLLC; Uncharacterized protein
STRINGSolyc08g077110.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-100NAC domain containing protein 71